MRPL50 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85322

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MRPL50 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRPL50. Peptide sequence: CREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLES The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MRPL50 Antibody - BSA Free

Western Blot: MRPL50 Antibody [NBP2-85322]

Western Blot: MRPL50 Antibody [NBP2-85322]

Western Blot: MRPL50 Antibody [NBP2-85322] - Host: Rabbit. Target Name: RM50. Sample Type: Stomach Tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for MRPL50 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPL50

MRPL50, also known as Mitochondrial Ribosomal Protein L50, consists of a 158 amino acid isoform that is 18 kDa, and is involved in the process of synthesizing proteins within the mitochondria. There is currently no research being conducted on the relationship between MRPL50 and any diseases. The protein interacts with ICT1, AARS2, AASS, ABCB7, and ACAD9, but is not linked to any biological processes or pathways.

Alternate Names

39S ribosomal protein L50, mitochondrial, FLJ20493, L50mt, mitochondrial 39S ribosomal protein L50, mitochondrial ribosomal protein L50, MRP-L50FLJ21990

Gene Symbol

MRPL50

Additional MRPL50 Products

Product Documents for MRPL50 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPL50 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPL50 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPL50 Antibody - BSA Free and earn rewards!

Have you used MRPL50 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies