MRS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59614

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MRS2L The peptide sequence was selected from the middle region of MRS2L. Peptide sequence LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MRS2 Antibody - BSA Free

Western Blot: MRS2 Antibody [NBP1-59614]

Western Blot: MRS2 Antibody [NBP1-59614]

Western Blot: MRS2 Antibody [NBP1-59614] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

Applications for MRS2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRS2

MRS2L is a magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix.

Alternate Names

HPT, MGC78523, mitochondrial, MRS2 magnesium homeostasis factor homolog (S. cerevisiae), MRS2-like protein, MRS2-like, magnesium homeostasis factor, MRS2-like, magnesium homeostasis factor (S. cerevisiae)

Gene Symbol

MRS2

UniProt

Additional MRS2 Products

Product Documents for MRS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRS2 Antibody - BSA Free and earn rewards!

Have you used MRS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for MRS2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I would like to know, please, if you sell an Mrs2 (Magnesium Transporter) antibody to detect yeast Mrs2. i have seen you have a a couple of them for detection of human Mrs2. As the sequence identity between both species (yeast and human) is low, I am not sure if these antibodies would cross react.

    A: Currently we have two antibodies to MRS2. Unfortunately, neither has been tested for cross reaction with the yeast protein. I was also not able to find the yeast sequence to run alignments against our products. If you have this and would like me to run an alignment against our two products, I would be happy to do so. We typically like to see 80+% homology between sequences for ideal cross reaction, but we have seen much lower percentages yield positive results. Since this species would not be covered under our 100% guarantee, we can offer you our Innovators Reward Program if you decide to try one of our products. In exchange for a review of your experiment using one of our products, we would issue you a credit for the purchase price of the antibody for use in a future purchase.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...