MTA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87849

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse MTA2. Peptide sequence: AWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTEPHSRGHLSRP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MTA2 Antibody - BSA Free

Western Blot: MTA2 Antibody [NBP2-87849]

Western Blot: MTA2 Antibody [NBP2-87849]

Western Blot: MTA2 Antibody [NBP2-87849] - WB Suggested Anti-MTA2 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:312500. Positive Control: NIH/3T3 cell lysate

Applications for MTA2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MTA2

Official Gene Symbol: MTA2 Gen Bank Accession Number: NP_004730 Gene ID: 9219 (Human) Gene Map Locus: 11q12-q13.1 (human) MTA2, a homologue of human MTA1 and MTA3, is a member of highly conserved MTA gene family. It is a component of NuRD, an ATP-dependent nucleosome remodeling and histone deacetylase complex. MTA2 is a nuclear protein that interacts with HDAC1 and HDAC2 and has a functional role in chromatin remodeling and deacetylase activity. MTA2 specifically interacts with p53 and represses p53-dependant transcriptional activation, thereby regulating p53-mediated cell growth arrest and apoptosis. It also inhibits the transcriptional activity of Estrogen receptor-alpha. Northern Blot analysis detected a ubiquitous expression of MTA2.

Alternate Names

DKFZp686F2281, metastasis associated 1 family, member 2, metastasis -associated gene 1-like 1, metastasis associated gene family, member 2, Metastasis-associated 1-like 1, metastasis-associated protein 2, metastasis-associated protein MTA2, MTA1-L1 protein, MTA1L1MTA1-L1, p53 target protein in deacetylase complex, PID

Gene Symbol

MTA2

Additional MTA2 Products

Product Documents for MTA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MTA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MTA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MTA2 Antibody - BSA Free and earn rewards!

Have you used MTA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...