MURF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55082

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MURF2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human TRIM55 (NP_908975). Peptide sequence SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MURF2 Antibody - BSA Free

Western Blot: MURF2 Antibody [NBP1-55082]

Western Blot: MURF2 Antibody [NBP1-55082]

Western Blot: MURF2 Antibody [NBP1-55082] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Applications for MURF2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MURF2

TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described.

Alternate Names

muRF2, MuRF-2, Muscle-specific RING finger protein 2, RING finger protein 29muscle specific ring finger 2, RNF29, tripartite motif containing 55, tripartite motif-containing 55, tripartite motif-containing protein 55

Entrez Gene IDs

84675 (Human)

Gene Symbol

TRIM55

UniProt

Q9BYV6 (Human)

Additional MURF2 Products

Product Documents for MURF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MURF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MURF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MURF2 Antibody - BSA Free and earn rewards!

Have you used MURF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies