MURF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52899

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to TRIM54(tripartite motif-containing 54) The peptide sequence was selected from the N terminal of TRIM54. Peptide sequence NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MURF3 Antibody - BSA Free

Western Blot: MURF3 Antibody [NBP1-52899]

Western Blot: MURF3 Antibody [NBP1-52899]

Western Blot: MURF3 Antibody [NBP1-52899] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for MURF3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 5 using NBP1-52899 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MURF3

TRIM54 contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles. The protein encoded by this gene contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Alternate Names

MuRF, MURF3, MURF-3, MURFtripartite motif-containing protein 54, Muscle-specific RING finger protein, Muscle-specific RING finger protein 3, RING finger protein 30muscle-specific RING-finger protein 3, RNF30, tripartite motif containing 54, tripartite motif-containing 54

Gene Symbol

TRIM54

Additional MURF3 Products

Product Documents for MURF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MURF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MURF3 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used MURF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • MURF3 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: C2C12 cell lysate
    Species: Mouse
    Verified Customer | Posted 01/06/2017
    Tissues or Cell Lines Tested: C2C12 Subcellular Fraction: RIPA diluted in 1% proteinase inhibitor of PBS Concentration: 1 µg/µl Preparation: 1. Perform a protein quantification assay (Bio-Red). Determine the protein concentration for each cell lysate. 2. Determine how much protein to load and add an equal volume 2X Laemmli sample buffer. 3. Boil each cell lysate in sample buffer at 100°C for 5 min. Controls: no positive control PAGE Gel: 10% PAGE Conditions: 60 volt for 1h, then 95 volt for 1-2h Membrane: PVDF 0.45µm Transfer Conditions: 35 volt, overnight Blocking Solution/ Duration: 5% milk in PBST for 1h at room temperature Primary Antibody Storage Conditions: -20C Reconstitution & Aliquot information: no Primary Antibody Diluent and Dilution: 1:500 in PBST contained 5% BSA Primary Antibody Incubation Time and Temperature: 4C overnight Wash Solution Composition, Repetitions & Times: PBST, three washes, 10 min each Secondary Antibody Manufacturer, Host Species: Jackson, anti-Rabbit-FRP Secondary Antibody Dilution, & Diluent: 1:4000 in PBST contained 5% milk Secondary Antibody Incubation Time & Temperature: 2h at room temperature Wash Solution Composition, Repetitions, & Times: PBST, three washes, 10 min each Detection Substrate: SuperSignal™ West Pico Chemiluminescent Substrate, catalog: 34080, Thermo Detection System, Procedure & Development Time: Acquire image using darkroom development techniques for chemiluminescence, development time: 5s Expected Molecular Weight: about 41 kDa Observed Molecular Weight: 48 kDa Controls: GAPDH Observations: 36 kDa
    MURF3 Antibody - BSA Free NBP1-52899

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...