Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to TRIM54(tripartite motif-containing 54) The peptide sequence was selected from the N terminal of TRIM54.
Peptide sequence NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for MURF3 Antibody - BSA Free
Western Blot: MURF3 Antibody [NBP1-52899]
Western Blot: MURF3 Antibody [NBP1-52899] - Hela cell lysate, concentration 0.2-1 ug/ml.Applications for MURF3 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Reviewed Applications
Read 1 review rated 5 using NBP1-52899 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MURF3
Alternate Names
MuRF, MURF3, MURF-3, MURFtripartite motif-containing protein 54, Muscle-specific RING finger protein, Muscle-specific RING finger protein 3, RING finger protein 30muscle-specific RING-finger protein 3, RNF30, tripartite motif containing 54, tripartite motif-containing 54
Gene Symbol
TRIM54
Additional MURF3 Products
Product Documents for MURF3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MURF3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for MURF3 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used MURF3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: C2C12 cell lysateSpecies: MouseVerified Customer | Posted 01/06/2017Tissues or Cell Lines Tested: C2C12 Subcellular Fraction: RIPA diluted in 1% proteinase inhibitor of PBS Concentration: 1 µg/µl Preparation: 1. Perform a protein quantification assay (Bio-Red). Determine the protein concentration for each cell lysate. 2. Determine how much protein to load and add an equal volume 2X Laemmli sample buffer. 3. Boil each cell lysate in sample buffer at 100°C for 5 min. Controls: no positive control PAGE Gel: 10% PAGE Conditions: 60 volt for 1h, then 95 volt for 1-2h Membrane: PVDF 0.45µm Transfer Conditions: 35 volt, overnight Blocking Solution/ Duration: 5% milk in PBST for 1h at room temperature Primary Antibody Storage Conditions: -20C Reconstitution & Aliquot information: no Primary Antibody Diluent and Dilution: 1:500 in PBST contained 5% BSA Primary Antibody Incubation Time and Temperature: 4C overnight Wash Solution Composition, Repetitions & Times: PBST, three washes, 10 min each Secondary Antibody Manufacturer, Host Species: Jackson, anti-Rabbit-FRP Secondary Antibody Dilution, & Diluent: 1:4000 in PBST contained 5% milk Secondary Antibody Incubation Time & Temperature: 2h at room temperature Wash Solution Composition, Repetitions, & Times: PBST, three washes, 10 min each Detection Substrate: SuperSignal™ West Pico Chemiluminescent Substrate, catalog: 34080, Thermo Detection System, Procedure & Development Time: Acquire image using darkroom development techniques for chemiluminescence, development time: 5s Expected Molecular Weight: about 41 kDa Observed Molecular Weight: 48 kDa Controls: GAPDH Observations: 36 kDa
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...