MYLIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54903

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MYLIP Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MYLIP (myosin regulatory light chain interacting protein). The peptide sequence was selected from the middle region of MYLIP. Peptide sequence CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MYLIP Antibody - BSA Free

Western Blot: MYLIP Antibody [NBP1-54903]

Western Blot: MYLIP Antibody [NBP1-54903]

Western Blot: MYLIP Antibody [NBP1-54903] - Titration: 0.2-1 ug/ml, Positive Control: SK-MEL-2 cell lysate.

Applications for MYLIP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MYLIP

The ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowthThe ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth.

Alternate Names

band 4.1 superfamily member BZF1, BZF1, cellular modulator of immune recognition (c-MIR), EC 6.3.2.-, Idol, IDOLmyosin regulatory light chain-interacting protein, Inducible degrader of the LDL-receptor, MIRE3 ubiquitin-protein ligase MYLIP, myosin regulatory light chain interacting proteinE3 ubiquitin ligase-inducible degrader of the low density lipoprotein receptor

Gene Symbol

MYLIP

UniProt

Q8WY64 (Human)

Additional MYLIP Products

Product Documents for MYLIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MYLIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MYLIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MYLIP Antibody - BSA Free and earn rewards!

Have you used MYLIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies