NCAPH2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09338

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NCAPH2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH2 (NP_689512). Peptide sequence EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NCAPH2 Antibody - BSA Free

Western Blot: NCAPH2 Antibody [NBP3-09338]

Western Blot: NCAPH2 Antibody [NBP3-09338]

Western Blot: NCAPH2 Antibody [NBP3-09338] - Western blot analysis using NBP3-09338 on Human HeLa as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for NCAPH2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NCAPH2

CAP-H2 (chromosome-associated protein H2) is 1 of 3 non-SMC subunits that define the condensin II complex. Condensin II along with the condensin I plays a critical role in mitotic chromosome assembly and segregation.

Alternate Names

CAP-H2, CAP-H2 subunit of the condensin II complex, CAPH2,384D8-2, Chromosome-associated protein H2, condensin-2 complex subunit H2, hCAP-H2, kleisin beta, Kleisin-beta, MGC15858, MGC18000, MGC2455, MGC4133, MGC5305, MGC8640, Non-SMC condensin II complex subunit H2, non-SMC condensin II complex, subunit H2

Gene Symbol

NCAPH2

Additional NCAPH2 Products

Product Documents for NCAPH2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NCAPH2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NCAPH2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NCAPH2 Antibody - BSA Free and earn rewards!

Have you used NCAPH2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies