NDC80 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56920

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NDC80 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDC80 Antibody - BSA Free

Western Blot: NDC80 Antibody [NBP2-56920]

Western Blot: NDC80 Antibody [NBP2-56920]

Western Blot: NDC80 Antibody [NBP2-56920] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: NDC80 Antibody [NBP2-56920]

Immunocytochemistry/ Immunofluorescence: NDC80 Antibody [NBP2-56920]

Immunocytochemistry/Immunofluorescence: NDC80 Antibody [NBP2-56920] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Applications for NDC80 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDC80

Human HEC1 is a coiled-coil protein that has been demonstrated to have a role in M-phase progression. It is essential for proper chromosome segregation. Its depletion results in the impairment of chromosome congression and results in spindle checkpoint activation.

Alternate Names

HEC1KNTC2, HECRetinoblastoma-associated protein HEC, Highly expressed in cancer protein, highly expressed in cancer, rich in leucine heptad repeats, highly expressed in cancer, rich in leucine heptad repeats (yeast), HsHec1, hsNDC80, kinetochore associated 2, Kinetochore protein Hec1, kinetochore protein NDC80 homolog, Kinetochore-associated protein 2, NDC80 homolog, kinetochore complex component (S. cerevisiae), TID3

Gene Symbol

NDC80

Additional NDC80 Products

Product Documents for NDC80 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDC80 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDC80 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDC80 Antibody - BSA Free and earn rewards!

Have you used NDC80 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies