NDUFA10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87891

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NDUFA10 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NDUFA10. Peptide sequence: AGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NDUFA10 Antibody - BSA Free

Western Blot: NDUFA10 Antibody [NBP2-87891]

Western Blot: NDUFA10 Antibody [NBP2-87891]

Western Blot: NDUFA10 Antibody [NBP2-87891] - Host: Rabbit. Target Name: NDUFA10. Sample Tissue: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for NDUFA10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFA10

NDUFA10 is encoded by this gene belongs to the complex I 42kDA subunit family. Mammalian complex I is the first enzyme complex in the electron transport chain of mitochondria. It is composed of 45 different subunits. This protein is a component of the hydrophobic protein fraction and has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain.

Alternate Names

10 (42kD), CI-42k, CI-42KD, FLJ21923, MGC5103, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial

Gene Symbol

NDUFA10

Additional NDUFA10 Products

Product Documents for NDUFA10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFA10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFA10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFA10 Antibody - BSA Free and earn rewards!

Have you used NDUFA10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies