NDUFA12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85363

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NDUFA12 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUFA12. Peptide sequence: VLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NDUFA12 Antibody - BSA Free

Western Blot: NDUFA12 Antibody [NBP2-85363]

Western Blot: NDUFA12 Antibody [NBP2-85363]

Western Blot: NDUFA12 Antibody [NBP2-85363] - Host: Rabbit. Target Name: NDUFA12. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for NDUFA12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFA12

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Alternate Names

13 kDa differentiation-associated protein, B17.2,13kDa differentiation-associated protein, CIB17.2, CI-B17.2, complex I B17.2 subunit, Complex I-B17.2, DAP13NADH-ubiquinone oxidoreductase subunit B17.2, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12, NADH: ubiquinone oxidoreductase

Gene Symbol

NDUFA12

Additional NDUFA12 Products

Product Documents for NDUFA12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFA12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFA12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFA12 Antibody - BSA Free and earn rewards!

Have you used NDUFA12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies