NDUFAF5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87892

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NDUFAF5 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse NDUFAF5. Peptide sequence: DTMLAAAAVYREMYRNEDGSIPATFQIYHMIGWKYHDSQARPAERGSAT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NDUFAF5 Antibody - BSA Free

Western Blot: NDUFAF5 Antibody [NBP2-87892]

Western Blot: NDUFAF5 Antibody [NBP2-87892]

Western Blot: NDUFAF5 Antibody [NBP2-87892] - Host: Rabbit. Target Name: Ndufaf5. Sample Type: Mouse Thymus lysates. Antibody Dilution: 1.0ug/ml

Applications for NDUFAF5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NDUFAF5

The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer ofelectrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the innermitochondrial membrane. This gene encodes a mitochondrial protein that is associated with the matrix face of themitochondrial inner membrane and is required for complex I assembly. A mutation in this gene results in mitochondrialcomplex I deficiency. Multiple transcript variants encoding different isoforms have been found for this gene.(provided by RefSeq)

Alternate Names

bA526K24.2, C20orf7, chromosome 20 open reading frame 7, dJ842G6.1, EC 2.1.1, EC 2.1.1.-, FLJ22324, MGC90272, NADH dehydrogenase (ubiquinone) complex I, assembly factor 5, probable methyltransferase C20orf7, mitochondrial

Gene Symbol

NDUFAF5

Additional NDUFAF5 Products

Product Documents for NDUFAF5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFAF5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFAF5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFAF5 Antibody - BSA Free and earn rewards!

Have you used NDUFAF5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies