NIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79883

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NIP Primary Antibodies »

Product Specifications

Immunogen

The specific Immunogen is proprietary information. Peptide sequence PEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYYRPRRLSLVPADVRGL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for NIP Antibody - BSA Free

Western Blot: NIP Antibody [NBP1-79883]

Western Blot: NIP Antibody [NBP1-79883]

Western Blot: NIP Antibody [NBP1-79883] - Jurkat Whole Cell, concentration 1 ug/ml.

Applications for NIP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NIP

NIP, also referred to as Dual oxidase maturation factor 1 (DUOXA1), contains a 38 kDa, a 54 kDa, and a 33 kDa isoform, and is involved in the maturation of the DUOX complex, which produces hydrogen peroxide for thyroid hormonogenesis. Current research is being conducted on NIP and its relation to several disorders and diseases, such as aortic valve insufficiency, hypothyroidism, thyroiditis, and breast cancer. NIP has not been found to interact with other proteins, but has been linked to the processes of protein transport and neuron differentiation.

Alternate Names

Dual oxidase activator 1, dual oxidase maturation factor 1, dual oxidase maturation factor 1 delta, dual oxidase maturation factor 1 gamma, FLJ32334, homolog of Drosophila Numb-interacting protein, mol, NIPdual oxidase maturation factor 1 alpha, Numb-interacting protein, NUMBIPdual oxidase maturation factor 1 beta

Gene Symbol

DUOXA1

UniProt

NP_653166 (Human)

Additional NIP Products

Product Documents for NIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NIP Antibody - BSA Free and earn rewards!

Have you used NIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for NIP Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am trying to find out whether your a-NIP antibody catalog number NBP1-79883 is suitable for use in Flow Cytometry?

    A: NBP1-79883 has not been tested in Flow Cytometry and we cannot guarantee its performance. If you would be interested in testing this antibody in Flow Cytometry, we can recommend our Innovators Reward Program is offered to reward researchers for testing new species and applications with our products. If testing on this antibody is performed on an untested species and/or application, and the results are shared, then the antibody is eligible for the Innovator's Reward. Under this program, Novus will provide you a credit of equal or lesser value on a future product of equal value in exchange for your new data in the form of an online review. The great thing is you are eligible even if the antibody doesn't work because the data is still useful to us.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies