NKX2.3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85385

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human NKX2.3. Peptide sequence: ADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NKX2.3 Antibody - BSA Free

Western Blot: NKX2.3 Antibody [NBP2-85385]

Western Blot: NKX2.3 Antibody [NBP2-85385]

Western Blot: NKX2.3 Antibody [NBP2-85385] - lane 1: Mouse Spleen lysate. primary antibody dilution: 1:1000. secondary antibody: goat anti-rabbit-HRP. secondary antibody dilution: 1:10,000. blocking buffer: 3% milk in TBST
Western Blot: NKX2.3 Antibody [NBP2-85385]

Western Blot: NKX2.3 Antibody [NBP2-85385]

Western Blot: NKX2.3 Antibody [NBP2-85385] - WB Suggested Anti-NKX2-3 Antibody Titration: 0.25ug/ml. Positive Control: Human Spleen

Applications for NKX2.3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NKX2.3

NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM]

Alternate Names

CSX3NK2.3, Homeobox protein NK-2 homolog C, homeobox protein Nkx-2.3, NK2 transcription factor related, locus 3 (Drosophila), NKX2.3, NKX23, NKX2CNK-2 (Drosophila) homolog C, NKX4-3

Gene Symbol

NKX2-3

Additional NKX2.3 Products

Product Documents for NKX2.3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NKX2.3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NKX2.3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NKX2.3 Antibody - BSA Free and earn rewards!

Have you used NKX2.3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...