NLRP5 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-93564
Select the "Bulk Orders" button to request additional sizes or formulations.
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 157-256 of human NLRP5 (NP_703148.4). TMTDQGPSKEKVPGISQAVQQDSATAAETKEQEISQAMEQEGATAAETEEQEISQAMEQEGATAAETEEQGHGGDTWDYKSHVMTKFAEEEDVRRSFENT
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
134 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for NLRP5 Antibody - BSA Free
Western Blot: NLRP5 AntibodyBSA Free [NBP2-93564]
Western Blot: NLRP5 Antibody [NBP2-93564] - Analysis of extracts of SKOV3 cells, using NLRP5 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 20S.Applications for NLRP5 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1:500-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: NLRP5
Alternate Names
CLR19.8, MATERMater protein homolog, NACHT, leucine rich repeat and PYD containing 5, NACHT, LRR and PYD domains-containing protein 5, NALP5maternal antigen that embryos require, NLR family, pyrin domain containing 5, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 5, PAN11, PYPAF8
Gene Symbol
NLRP5
Additional NLRP5 Products
Product Documents for NLRP5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NLRP5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for NLRP5 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review NLRP5 Antibody - BSA Free and earn rewards!
Have you used NLRP5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...