Home / NOP Receptor Antagonists / Nocistatin (human)

Nocistatin (human)

Catalog #: 1198
1 Citation Datasheet / COA / SDS

Discontinued Product

1198 has been discontinued.
View all NOP Receptor Antagonists products.
Nocistatin (human)
1 Image
Description: Human putative counterpart of nocistatin
Product Details
Citations (1)
Reviews
Biological Activity Technical Data Background Product Datasheets Calculators

Biological Activity

Nocistatin (human) is a human putative counterpart of nocistatin (bovine). Blocks nociceptin-induced allodynia and hyperalgesia.

Technical Data

M.Wt:
3561.93
Formula:
C149H238N42O53S3
Sequence:
MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ
Storage:
Desiccate at -20°C
CAS No:
212609-11-5

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Certificate of Analysis is currently unavailable on-line. Please contact Customer Service
SDS
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citation for Nocistatin (human)

The citations listed below are publications that use Tocris products. Selected citations for Nocistatin (human) include:

1 Citation: Showing 1 - 1

  1. Nociceptin/orphanin FQ exacerbates excitotoxic white-matter lesions in the murine neonatal brain.
    Authors: Laudenbach Et al.
    J Clin Invest  2001;107:457

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Nocistatin (human)

There are currently no reviews for this product. Be the first to review Nocistatin (human) and earn rewards!

Have you used Nocistatin (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.