Nocistatin (human)

  ( 1 citations )    
Product Datasheet
Catalog Number:1198
Chemical Name:
Product Details
Citations (1)
Supplemental Products
Reviews
Biological Activity
Human putative counterpart of nocistatin (bovine). Blocks nociceptin-induced allodynia and hyperalgesia.
Technical Data
  • M.Wt:
    3561.93
  • Formula:
    C149H238N42O53S3
  • Sequence:
    MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ
  • Storage:
    Desiccate at -20°C
  • CAS No:
    212609-11-5
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
Certificate of Analysis is currently unavailable
on-line. Please contact Customer Service
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Nocistatin (human) include:

1 Citations: Showing 1 - 1

  1. Nociceptin/orphanin FQ exacerbates excitotoxic white-matter lesions in the murine neonatal brain.
    Authors: Laudenbach Et al.
    J Clin Invest  2001;107:457

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used Nocistatin (human)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee