Catalog Number: 1984
Alternate Names: NEP1-40, Nogo Extracellular Peptide, 1-40
Biological Activity
Peptide fragment corresponding to residues 1 - 40 of Nogo-66, the domain of the myelin protein Nogo that inhibits axonal outgrowth. Acts as a competitive antagonist at the Nogo-66 receptor (NgR); blocks Nogo-66- and CNS myelin-induced inhibition of axonal growth, but does not reduce myelin-associated glycoprotein (MAG) inhibition of neurite outgrowth in vitro. Promotes regeneration of hemisected spinal axons and locomotor recovery following spinal injury in vivo.
Technical Data
  • M.Wt:
    4625.16
  • Formula:
    C206H324N56O65
  • Sequence:
    RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS

    (Modifications: Arg-1 = N-terminal Ac, Ser-40 = C-terminal amide)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    475221-20-6
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Nogo-66 receptor antagonist peptide promotes axonal regeneration.
    GrandPre et al.
    Nature, 2002;417:547
  2. Myelin-associated glycoprotein as a functional ligand for the Nogo-66 receptor.
    Liu et al.
    Science, 2002;297:1190
  3. Delayed systemic Nogo-66 receptor antagonist promotes recovery from spinal cord injury.
    Li and Strittmatter
    J.Neurosci., 2003;23:4219

Have you used Nogo-66 (1-40)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information