NOL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87933

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NOL1. Peptide sequence: PEQPFEKAAFQKQNDTPKGPQPPTVSPIRSSRPPPAKRKKSQSRGNSQLL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NOL1 Antibody - BSA Free

Western Blot: NOL1 Antibody [NBP2-87933]

Western Blot: NOL1 Antibody [NBP2-87933]

Western Blot: NOL1 Antibody [NBP2-87933] - Host: Rabbit. Target Name: NOP2. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for NOL1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NOL1

Nucleolar protein 1 (NOL1) is a protein highly expressed in proliferating cells; it is expressed in G1 and peaks during early S phase. It is proposed to play a role in the regulation of the cell cycle, and it may function as a ribosomal RNA methyltransferase. Alternative names for NOL1 include p120 nucleolar-proliferation antigen, nucleolar protein 2 homolog, proliferating-cell nucleolar antigen p120, proliferation-associated nucleolar protein p120, NSUN1, and NOP2.

Alternate Names

EC 2.1.1, EC 2.1.1.-, MGC149287, MGC149288, NOL1/NOP2/Sun domain family, member 1, NOL1MGC117384, NOP120, NOP2 nucleolar protein homolog (yeast), NOP2/Sun domain family, member 1, NSUN1, Nucleolar protein 1, nucleolar protein 1 (120kD), nucleolar protein 1, 120kDa, Nucleolar protein 2 homolog, nucleolar protein 2 homolog (yeast), p120, Proliferating-cell nucleolar antigen p120, Proliferation-associated nucleolar protein p120, putative ribosomal RNA methyltransferase NOP2

Gene Symbol

NOP2

Additional NOL1 Products

Product Documents for NOL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NOL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NOL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NOL1 Antibody - BSA Free and earn rewards!

Have you used NOL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...