NORE1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-57516PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all NORE1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NORE1.

Source: E. coli

Amino Acid Sequence: EGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57516.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-57516PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NORE1

NORE1 (also referred to as Ras Association (RalGDS/AF-6) Domain Family Member 5) is a tumor suppressor and induces apoptosis. NORE1 is known to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E. NORE1 has been studied in relation to several types of cancer including lung cancer, breast cancer, clear cell renal cell carcinoma, thyroid carcinoma, and follicular thyroid carcinoma.

Alternate Names

Maxp1, MGC10823, MGC17344, New ras effector 1, NORE1A, NORE1B, NORE1RASSF3, Rap1-binding protein, RAPLnovel Ras effector 1, Ras association (RalGDS/AF-6) domain family 5, Ras association (RalGDS/AF-6) domain family member 5, ras association domain-containing protein 5, Ras effector-like protein, regulator for cell adhesion and polarization enriched in lymphoid tissue, Regulator for cell adhesion and polarization enriched in lymphoid tissues, tumor suppressor RASSF3

Gene Symbol

RASSF5

Additional NORE1 Products

Product Documents for NORE1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NORE1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for NORE1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review NORE1 Recombinant Protein Antigen and earn rewards!

Have you used NORE1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes