Nova1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57397

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Nova1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to NOVA1(neuro-oncological ventral antigen 1) The peptide sequence was selected from the C terminal of NOVA1. Peptide sequence SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Nova1 Antibody - BSA Free

Western Blot: Nova1 Antibody [NBP1-57397]

Western Blot: Nova1 Antibody [NBP1-57397]

Western Blot: Nova1 Antibody [NBP1-57397] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: Nova1 Antibody [NBP1-57397]

Western Blot: Nova1 Antibody [NBP1-57397]

Western Blot: Nova1 Antibody [NBP1-57397] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Applications for Nova1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nova1

NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer.This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described.

Alternate Names

neuro-oncological ventral antigen 1Nova-1, Onconeural ventral antigen 1, Paraneoplastic Ri antigen, RNA-binding protein Nova-1, Ventral neuron-specific protein 1

Gene Symbol

NOVA1

UniProt

A8K603 (Human)

Additional Nova1 Products

Product Documents for Nova1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Nova1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nova1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nova1 Antibody - BSA Free and earn rewards!

Have you used Nova1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies