NPAS2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-10408
Loading...
Key Product Details
Species Reactivity
Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_032745). Peptide sequence VSYADVRVERRQELALEDPPTEAMHPSAVKEKDSSLEPPQPFNALDMGAS
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for NPAS2 Antibody - BSA Free
Western Blot: NPAS2 Antibody [NBP3-10408]
Western Blot: NPAS2 Antibody [NBP3-10408] - Western blot analysis of NPAS2 in Mouse Muscle as a positive control. Antibody dilution at 0.2-1 ug/mlApplications for NPAS2 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: NPAS2
Alternate Names
Basic-helix-loop-helix-PAS protein MOP4, BHLHE9, bHLHe9MGC71151, Class E basic helix-loop-helix protein 9, Member of PAS protein 4, member of PAS superfamily 4, MOP4PAS domain-containing protein 4, neuronal PAS domain protein 2, neuronal PAS domain-containing protein 2, Neuronal PAS2, PASD4FLJ23138
Gene Symbol
NPAS2
Additional NPAS2 Products
Product Documents for NPAS2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NPAS2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for NPAS2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review NPAS2 Antibody - BSA Free and earn rewards!
Have you used NPAS2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...