NRIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87941

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NRIP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human NRIP. Peptide sequence: LMLEETRNTITVPASFMLRMLASLNHIRADRLEGDRSEGSGQENENEDEE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for NRIP Antibody - BSA Free

Western Blot: NRIP Antibody [NBP2-87941]

Western Blot: NRIP Antibody [NBP2-87941]

Western Blot: NRIP Antibody [NBP2-87941] - Host: Rabbit. Target Name: IQWD1. Sample Type: OVCAR-3 Whole cell lysates. Antibody Dilution: 1.0ug/ml

Applications for NRIP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NRIP

WD-repeat proteins are a large family of eukaryotic proteins coordinating multi-protein complex assemblies. Their role has been implicated in multiple cellular processes including signal transduction, transcriptional regulation, cell cycle control and apoptosis. NRIP is a novel 860a.a nuclear protein consisting of seven conserved WD40 domains and one NLS motif. It binds to androgen and glucocorticoid receptors and up-regulates their transcriptional activity, thereby functioning as a nuclear receptor co-activator. Role of NRIP has been implicated in cell growth and also in cervical and prostrate cancer, thus indicating a potential therapeutic intervention. Northern Blot analysis detects a high expression of NRIP in skeletal muscle and testis and low expression in heart, prostrate and adrenal gland.

Alternate Names

1200006M05Rik, Androgen receptor complex-associated protein, ARCAP, DDB1 and CUL4 associated factor 6, DDB1- and CUL4-associated factor 6, FLJ23798, IQ motif and WD repeat-containing protein 1, IQ motif and WD repeats 1, IQWD1, MSTP055, NRIP, Nuclear receptor interaction protein, PC326

Gene Symbol

DCAF6

Additional NRIP Products

Product Documents for NRIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NRIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NRIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NRIP Antibody - BSA Free and earn rewards!

Have you used NRIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies