NUFIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87965

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all NUFIP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NUFIP1. Peptide sequence: GQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKNSYYPRKYDAKFTDFSL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit NUFIP1 Antibody - BSA Free (NBP2-87965) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for NUFIP1 Antibody - BSA Free

Western Blot: NUFIP1 Antibody [NBP2-87965]

Western Blot: NUFIP1 Antibody [NBP2-87965]

Western Blot: NUFIP1 Antibody [NBP2-87965] - Host: Rabbit. Target Name: NUFIP1. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml
Western Blot: NUFIP1 Antibody [NBP2-87965]

Western Blot: NUFIP1 Antibody [NBP2-87965]

Western Blot: NUFIP1 Antibody [NBP2-87965] - WB Suggested Anti-NUFIP1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Transfected 293T
Western Blot: NUFIP1 Antibody [NBP2-87965]

Western Blot: NUFIP1 Antibody [NBP2-87965]

Western Blot: NUFIP1 Antibody [NBP2-87965] - Host: Rabbit. Target Name: NUFIP1. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml

Applications for NUFIP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NUFIP1

NUFIP1, also known as Nuclear fragile X mental retardation-interacting protein 1, is a 495 amino acid protein that is 56 kDa, binds RNA, contains a C2H2 zinc finger motif and a nuclear localization signal, it is associated with the nuclear matrix in perichromatin fibrils and, in neurons, localizes to the cytoplasm in association with endoplasmic reticulum ribosomes. Current research is being performed on several diseases and disorders including intellectual disability, neuronitis, microcephaly, and prostatitis. This protein has been shown to have interactions with YWHAZ, BRCA1, CCNT1, RUVBL2, FMR1, and over 30 other proteins in box C/D snoRNP assembly, RNA processing, and positive regulation of transcription from RNA polymerase II promoter pathways.

Alternate Names

bA540M5.1, nuclear fragile X mental retardation protein interacting protein 1, nuclear fragile X mental retardation protein-interacting protein 1, nuclear fragile X mental retardation-interacting protein 1, NUFIP, NUFIPNuclear FMRP-interacting protein 1

Gene Symbol

NUFIP1

Additional NUFIP1 Products

Product Documents for NUFIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NUFIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NUFIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NUFIP1 Antibody - BSA Free and earn rewards!

Have you used NUFIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies