OAS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58951

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OAS2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to OAS2(2'-5'-oligoadenylate synthetase 2, 69/71kDa) The peptide sequence was selected from the N terminal of OAS2. Peptide sequence DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for OAS2 Antibody - BSA Free

Western Blot: OAS2 Antibody [NBP1-58951]

Western Blot: OAS2 Antibody [NBP1-58951]

Western Blot: OAS2 Antibody [NBP1-58951] - SH-SYSY cell lysate, concentration 0.2-1 ug/ml.

Applications for OAS2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OAS2

OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Alternatively spliced transcript variants encoding different isoforms have been described.

Long Name

2’,5’-Oligoadenylate Synthetase-2

Alternate Names

(2-5')oligo(A) synthase 2, (2'-5')oligo(A) synthetase 2, (2-5')oligo(A) synthetase 2, 2'5' oligoadenylate synthetase 2, 2-5A synthase 2, 2-5A synthetase 2, 2'-5'-oligoadenylate synthase 2, 2'-5'-oligoadenylate synthetase 2 (69-71 kD), 2'-5'-oligoadenylate synthetase 2, 69/71kDa, EC 2.7.7, EC 2.7.7.-, MGC78578, p69 OAS / p71 OAS, p69OAS / p71OAS

Gene Symbol

OAS2

UniProt

P29728-2 (Human)

Additional OAS2 Products

Product Documents for OAS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OAS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OAS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OAS2 Antibody - BSA Free and earn rewards!

Have you used OAS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies