OASIS/CREB3L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25027

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all OASIS/CREB3L1 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein OASIS/CREB3L1 using the following amino acid sequence: MATTPLLGLSPLSRLPIPHQAPGEMTQLPVIKAEPLEVNQFLKVTPEDLVQMPPTP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for OASIS/CREB3L1 Antibody - BSA Free

OASIS/CREB3L1 Antibody Immunocytochemistry/Immunofluorescence: OASIS/CREB3L1 Antibody [NBP3-25027]

Immunocytochemistry/Immunofluorescence: OASIS/CREB3L1 Antibody [NBP3-25027]

Staining of human cell line U-251MG shows localization to nucleoplasm.

Applications for OASIS/CREB3L1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OASIS/CREB3L1

Transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein responsetarget genes. Specifically involved in ER-stress response in astrocytes in the central nervous system (Bysimilartity). May play a role in gliosis. In vitro, binds to box-B element, cAMP response element (CRE) and CRE-likesequences, and activates transcription through box-B element but not through CRE

Long Name

Old Astrocyte Specifically Induced Substance

Alternate Names

BBF-2 Homolog, CREB3L1

Gene Symbol

CREB3L1

Additional OASIS/CREB3L1 Products

Product Documents for OASIS/CREB3L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for OASIS/CREB3L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OASIS/CREB3L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OASIS/CREB3L1 Antibody - BSA Free and earn rewards!

Have you used OASIS/CREB3L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

TGF-beta Signaling Pathways TGF-beta Signaling Pathway Thumbnail