Ocular development associated gene Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-87979
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human Ocular development associated gene. Peptide sequence: KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKES The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Description
Novus Biologicals Rabbit Ocular development associated gene Antibody - BSA Free (NBP2-87979) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Ocular development associated gene Antibody - BSA Free
Western Blot: Ocular development associated gene Antibody [NBP2-87979]
Western Blot: Ocular development associated gene Antibody [NBP2-87979] - WB Suggested Anti-GATAD1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: K562 cell lysateGATAD1 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cellsApplications for Ocular development associated gene Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Ocular development associated gene
Alternate Names
FLJ22489, GATA zinc finger domain containing 1, GATA zinc finger domain-containing protein 1, ocular development associated, Ocular development-associated gene protein, ODAGFLJ40695, RG083M05.2
Gene Symbol
GATAD1
Additional Ocular development associated gene Products
Product Documents for Ocular development associated gene Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Ocular development associated gene Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Ocular development associated gene Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Ocular development associated gene Antibody - BSA Free and earn rewards!
Have you used Ocular development associated gene Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...