OD1

Catalog # Availability Size / Price Qty
5941/10U
Cat.No. 5941 - OD1 | Gly-Val-Arg-Asp-Ala-Tyr-Ile-Ala-Asp-Asp-Lys-Asn-Cys-Val-Tyr-Thr-Cys-Ala-Ser-Asn-Gly-Tyr-Cys-Asn-Thr-Glu-Cys-Thr-Lys-Asn-Gly-Ala-Glu-Ser-Gly-Tyr-Cys-Gln-Trp-Ile-Gly-Arg-Tyr-Gly-Asn-Ala-Cys-Trp-Cys-Ile-Lys-Leu-Pro-Asp-Glu-Val-Pro-Ile-Ar
1 Image
Description: Potent hNav1.4, rNav1.6 and rNav1.7 channel activator
Product Details
Reviews

Biological Activity

Potent rat Nav1.7, human Nav1.4 and rat Nav1.6 channel activator (EC50 values are 7, 10 and 47 nM, respectively). Exhibits minimal activation at mammalian Nav1.2, Nav1.3 and Nav1.5 (EC50 values >3 μM). Inhibits fast inactivation on all channels. Increases peak currents at all voltages and stimulates a persistent Na+ current at hNav1.7 channel. Increases hyperpolarization at Nav1.4 and Nav1.6 channels. Induces spontaneous pain in vivo.

Technical Data

M.Wt:
7206.1
Formula:
C308H466N90O95S8
Sequence:
GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR

(Modifications: Disulfide bridge: 13-64, 17-37, 23-47, 27-49, Arg-65 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for OD1

There are currently no reviews for this product. Be the first to review OD1 and earn rewards!

Have you used OD1?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.