OR10AD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83309

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR10AD1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10AD1. Peptide sequence: LSKASSSGRGKTFSTCASHLTVVIFLYTSAMFSYMNPHSTHGPDKDKPFS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for OR10AD1 Antibody - BSA Free

Western Blot: OR10AD1 Antibody [NBP2-83309]

Western Blot: OR10AD1 Antibody [NBP2-83309]

Western Blot: OR10AD1 Antibody [NBP2-83309] - Host: Rabbit. Target Name: OR10AD1. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for OR10AD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR10AD1

Olfactory Receptor, Family 10, Subfamily AD, Member 1 (OR10AD1) is a member of the G-protein-coupled receptors (GPCR). Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Alternate Names

olfactory receptor 10AD1, Olfactory receptor OR12-1, olfactory receptor, family 10, subfamily AD, member 1, olfactory receptor, family 10, subfamily AD, member 1 pseudogene, OR10AD1P, OR12-1

Gene Symbol

OR10AD1

Additional OR10AD1 Products

Product Documents for OR10AD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR10AD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR10AD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR10AD1 Antibody - BSA Free and earn rewards!

Have you used OR10AD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies