OR1C1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84200

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR1C1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of mouse OR1C1. Peptide sequence: SVIYVYFRPLSMYSVVKDRIATVMYTVVTPMMNPFIYSLRNKDMKRGLRK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for OR1C1 Antibody - BSA Free

Western Blot: OR1C1 Antibody [NBP2-84200]

Western Blot: OR1C1 Antibody [NBP2-84200]

Western Blot: OR1C1 Antibody [NBP2-84200] - Host: Rabbit. Target Name: Olfr364-ps1. Sample Type: Mouse Lung lysates. Antibody Dilution: 1.0ug/ml

Applications for OR1C1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR1C1

OR1C1, also known as Olfactory receptor 1C1, is a 35 kDa, 314 amino acid protein that is involved in reception and transduction of odor signals in order to trigger the sense of smell. Diseases such as neuronitis are currently being researched for their link to the protein. The protein interacts with OR2G2, OR2G3, OR2M4, OR14A16, and OR52E6 in olfactory and GPCR downstream signal transduction pathways.

Alternate Names

HSTPCR27, olfactory receptor 1C1, Olfactory receptor OR1-42, Olfactory receptor TPCR27, olfactory receptor, family 1, subfamily C, member 1, OR1.5.10, OR1-42, ORL211, TPCR27

Gene Symbol

OR1C1

Additional OR1C1 Products

Product Documents for OR1C1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR1C1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR1C1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR1C1 Antibody - BSA Free and earn rewards!

Have you used OR1C1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies