OR1J4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09722

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR1J4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR1J4 (NP_001004452). Peptide sequence ALSTCGSHLSVVSLYYGTIIGLYFLPSSSASSDKDVIASVMYTVITPLLN

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OR1J4 Antibody - BSA Free

Western Blot: OR1J4 Antibody [NBP3-09722]

Western Blot: OR1J4 Antibody [NBP3-09722]

Western Blot: OR1J4 Antibody [NBP3-09722] - Western blot analysis of OR1J4 in MDA-MB-435S Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for OR1J4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR1J4

OR1J4, also known as Olfactory receptor 1J4, is a 35 kDa, 313 amino acid protein that is involved in the reception of odors in order to initiate the perception of smell. Current research is being conducted to determine the protein's effect on diseases such as neuronitis. The protein interacts in olfactory and GPCR signal transduction pathways with OR4F15, OR2AT4, OR52E6, OR2C3, and OR10A3.

Alternate Names

HSHTPCRX01, HTPCRX01, olfactory receptor 1J4, olfactory receptor, family 1, subfamily J, member 4, OR9-21

Gene Symbol

OR1J4

Additional OR1J4 Products

Product Documents for OR1J4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR1J4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR1J4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR1J4 Antibody - BSA Free and earn rewards!

Have you used OR1J4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies