OR2AG1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09526

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2AG1 (NP_001004489). Peptide sequence LAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OR2AG1 Antibody - BSA Free

Western Blot: OR2AG1 Antibody [NBP3-09526]

Western Blot: OR2AG1 Antibody [NBP3-09526]

Western Blot: OR2AG1 Antibody [NBP3-09526] - Western blot analysis of OR2AG1 in Hela Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for OR2AG1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR2AG1

OR2AG1, also known as Olfactory receptor 2AG1, is a 35.3 kDa, 316 amino acid protein that is involved in odor reception as a member of the olfactory receptor gene family, which is the largest gene family in the genome. Current research is determining the protein's effect on diseases such as hereditary hemorrhagic telangiectasia, neuronitis, and telangiectasis. The protein interacts in olfactory signaling and GPCR downstream signaling pathways with OR1D2, GNGT1, GNAL, OR52E6, and MPDZ.

Alternate Names

HT3, hT3 olfactory receptor, olfactory receptor 2AG1, Olfactory receptor 2AG3, Olfactory receptor OR11-79, olfactory receptor, family 2, subfamily AG, member 1, olfactory receptor, family 2, subfamily AG, member 3, OR11-79, OR2AG3

Gene Symbol

OR2AG1

Additional OR2AG1 Products

Product Documents for OR2AG1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR2AG1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR2AG1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR2AG1 Antibody - BSA Free and earn rewards!

Have you used OR2AG1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...