OR2H2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09987

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR2H2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR90 (NP_009091.3). Peptide sequence LQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFRRLLGKEM

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OR2H2 Antibody - BSA Free

Western Blot: OR2H2 Antibody [NBP3-09987]

Western Blot: OR2H2 Antibody [NBP3-09987]

Western Blot: OR2H2 Antibody [NBP3-09987] - Western blot analysis of OR2H2 in Mouse Liver lysates. Antibody dilution at 1.0ug/ml

Applications for OR2H2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR2H2

OR2H2, also known as Olfactory receptor 2H2, is a 34.7 kDa, 312 amino acid protein that is involved in recognition and transduction of odorant signals as a member of the olfactory receptor gene family. Diseases such as lupus erythematosus, multiple sclerosis, systemic lupus erythematosus, and neuronitis are currently being researched with the protein. The protein interacts in signal transduction, GPCR downstream signaling, and olfactory signaling pathways.

Alternate Names

FAT11, hs6M1-12, MGC126732, MGC138381, Olfactory receptor 2, olfactory receptor 2H2, Olfactory receptor 2H3, olfactory receptor OR6-36, olfactory receptor, family 2, subfamily H, member 2, olfactory receptor, family 2, subfamily H, member 3, Olfactory receptor-like protein FAT11, OLFR2OLFR42B, OR2H3dJ271M21.2

Gene Symbol

OR2H2

Additional OR2H2 Products

Product Documents for OR2H2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR2H2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR2H2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR2H2 Antibody - BSA Free and earn rewards!

Have you used OR2H2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies