OR2S2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09773

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR2S2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2S2 (NP_063950). Peptide sequence KKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OR2S2 Antibody - BSA Free

Western Blot: OR2S2 Antibody [NBP3-09773]

Western Blot: OR2S2 Antibody [NBP3-09773]

Western Blot: OR2S2 Antibody [NBP3-09773] - Western blot analysis of OR2S2 in HepG2 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for OR2S2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR2S2

OR2S2, also known as Olfactory receptor 2S2, is a 35.2 kDa, 319 amino acid protein that is involved in odor reception in the nose as a member of the G-protein-coupled receptors. Current research is determining the effect of the protein on diseases such as neuronitis. The protein interacts with OR1D2, OR10J1, OR52E6, and GNAL proteins in olfactory transduction and GPCR downstream signaling pathways.

Alternate Names

olfactory receptor 2S2, Olfactory receptor OR9-3, olfactory receptor, family 2, subfamily S, member 2, OR37A, OST715

Gene Symbol

OR2S2

Additional OR2S2 Products

Product Documents for OR2S2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR2S2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR2S2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR2S2 Antibody - BSA Free and earn rewards!

Have you used OR2S2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies