OR4D10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09784

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4D10 (NP_001004705). Peptide sequence FILELLMISNNGLLTTLWFFLLLVSYIVILSLPKSQAGEGRRKAISTCTS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OR4D10 Antibody - BSA Free

Western Blot: OR4D10 Antibody [NBP3-09784]

Western Blot: OR4D10 Antibody [NBP3-09784]

Western Blot: OR4D10 Antibody [NBP3-09784] - Western blot analysis of OR4D10 in Human HepG2 Whole Cell. Antibody dilution at 1ug/ml

Applications for OR4D10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR4D10

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq]

Alternate Names

olfactory receptor 4D10, Olfactory receptor OR11-251, olfactory receptor, family 4, subfamily D, member 10, olfactory receptor, family 4, subfamily D, member 10 pseudogene, OR11-251, OR4D10P, OST711, seven transmembrane helix receptor

Gene Symbol

OR4D10

Additional OR4D10 Products

Product Documents for OR4D10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR4D10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR4D10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR4D10 Antibody - BSA Free and earn rewards!

Have you used OR4D10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...