OR4F4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09786

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all OR4F4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR4F4 (NP_001004195). Peptide sequence PIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAHSSVKF

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for OR4F4 Antibody - BSA Free

Western Blot: OR4F4 Antibody [NBP3-09786]

Western Blot: OR4F4 Antibody [NBP3-09786]

Western Blot: OR4F4 Antibody [NBP3-09786] - Western blot analysis of OR4F4 in 721_B Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for OR4F4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: OR4F4

OR4F4, also known as Olfactory receptor 4F4, is a 34.3 kDa, 305 amino acid protein that is utilized in a 7-transmembrane domain structure that recognizes and sends odorant signals to the brain. The protein is currently being researched for its involvement in neuronitis. The protein interacts in GPCR downstream signaling, olfactory transduction, and signal transduction pathways with ARRB2, GNAL, and ADRBK2.

Alternate Names

HS14a-1-A, OLA-7501, olfactory receptor 4F4, Olfactory receptor OR19-3, olfactory receptor, family 4, subfamily F, member 18, olfactory receptor, family 4, subfamily F, member 4, OR4F17, OR4F18

Gene Symbol

OR4F4

Additional OR4F4 Products

Product Documents for OR4F4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for OR4F4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for OR4F4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review OR4F4 Antibody - BSA Free and earn rewards!

Have you used OR4F4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies