ORC3L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55490

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ORC3L Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ORC3L Antibody - BSA Free

Western Blot: ORC3L Antibody [NBP2-55490]

Western Blot: ORC3L Antibody [NBP2-55490]

Western Blot: ORC3L Antibody [NBP2-55490] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ORC3L Antibody [NBP2-55490]

Immunocytochemistry/ Immunofluorescence: ORC3L Antibody [NBP2-55490]

Immunocytochemistry/Immunofluorescence: ORC3L Antibody [NBP2-55490] - Staining of human cell line HEK 293 shows localization to nucleoplasm.

Applications for ORC3L Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ORC3L

ORC3L is involved in DNA replication origin binding.

Alternate Names

IMAGE50150, LAT, LATHEOorigin recognition complex, subunit 3-like (yeast), ORC3Lhomolog of latheo, Drosophila, origin recognition complex subunit 3, Origin recognition complex subunit Latheo, origin recognition complex, subunit 3, origin recognition complex, subunit 3 (yeast homolog)-like, origin recognition complex, subunit 3 honolog, origin recognition complex, subunit 3 honolog (yeast), origin recognition complex, subunit 3-like

Gene Symbol

ORC3

Additional ORC3L Products

Product Documents for ORC3L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ORC3L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ORC3L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ORC3L Antibody - BSA Free and earn rewards!

Have you used ORC3L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies