P2Y2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86745

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all P2Y2/P2RY2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of P2Y2. Peptide sequence: KPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTESTPAGSE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for P2Y2 Antibody - BSA Free

Western Blot: P2Y2 Antibody [NBP2-86745]

Western Blot: P2Y2 Antibody [NBP2-86745]

Western Blot: P2Y2 Antibody [NBP2-86745] - Host: Rabbit. Target Name: P2RY2. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 3ug/ml
Western Blot: P2Y2 Antibody [NBP2-86745]

Western Blot: P2Y2 Antibody [NBP2-86745]

Western Blot: P2Y2 Antibody [NBP2-86745] - WB Suggested Anti-P2RY2 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellP2RY2 is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: P2Y2 Antibody [NBP2-86745]

Western Blot: P2Y2 Antibody [NBP2-86745]

Western Blot: P2Y2 Antibody [NBP2-86745] - Host: Rabbit. Target: P2RY2. Positive control (+): THP-1 (N30). Negative control (-): A549 (N03). Antibody concentration: 5ug/ml

Applications for P2Y2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: P2Y2/P2RY2

P2Y2 belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is responsive to both adenosine and uridine nucleotides. It may participate in control of the cell cycle of endometrial carcinoma cells. P2Y2 is also a morphogen receptor that potentiates neurotrophin signaling in neuronal development and regeneration.

Long Name

P2Y Purinergic Receptor 2

Alternate Names

P2RU1, P2RY2, P2U, P2U1, P2Y2R

Gene Symbol

P2RY2

Additional P2Y2/P2RY2 Products

Product Documents for P2Y2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for P2Y2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for P2Y2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review P2Y2 Antibody - BSA Free and earn rewards!

Have you used P2Y2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies