Catalog Number: 3236
Biological Activity
Potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist (IC50 = 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Antitumor activity in vivo.
Technical Data
  • M.Wt:
    4024.78
  • Formula:
    C182H300N56O45S
  • Sequence:
    FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

    (Modifications: Lys-33 = C-terminal amide)

  • Solubility:
    Soluble to 2 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    143748-18-9
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. The neuropeptide PACAP promotes a-secretase pathway for processing Alzheimer amyloid precursor protein.
    Kojro et al.
    FASEB J., 2006;20:512
  2. Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist.
    Robberecht et al.
    Eur.J.Biochem., 1992;207:239
  3. PACAP(6-38) inhibits growth of prostate cancer cells.
    Leyton et al.
    Cancer Lett., 1998;125:131
Citations:

The citations listed below are publications that use Tocris products. Selected citations for PACAP 6-38 include:

1 Citations: Showing 1 - 1

  1. PACAP and VIP Inhibit the Invasiveness of Glioblastoma Cells Exposed to Hypoxia through the Regulation of HIFs and EGFR Expression.
    Authors: Maugeri Et al.
    Proc Natl Acad Sci U S A 2016;7:139

Have you used PACAP 6-38?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information