PAGE1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58313

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PAGE1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PAGE1(P antigen family, member 1 (prostate associated)) The peptide sequence was selected from the middle region of PAGE1. Peptide sequence TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PAGE1 Antibody - BSA Free

Western Blot: PAGE1 Antibody [NBP1-58313]

Western Blot: PAGE1 Antibody [NBP1-58313]

Western Blot: PAGE1 Antibody [NBP1-58313] - 721_B cell lysate, concentration 5.0ug/ml.

Applications for PAGE1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PAGE1

PAGE1 belongs to a family that are expressed in a variety of tumors but not in normal tissues, except for the testis. Nothing is presently known about the function of this protein.This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. Unlike the other gene family members, this gene does not encode an antigenic peptide. Nothing is presently known about the function of this protein.

Alternate Names

CT16.3, G antigen, family B, 1 (prostate associated), GAGE9, GAGE-9AL5, GAGEB1G antigen family B member 1, P antigen family, member 1 (prostate associated), PAGE-1G antigen 9, prostate associated gene 1, Prostate-associated gene 1 protein

Gene Symbol

PAGE1

UniProt

O75459 (Human)

Additional PAGE1 Products

Product Documents for PAGE1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PAGE1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PAGE1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PAGE1 Antibody - BSA Free and earn rewards!

Have you used PAGE1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies