PARD6B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10560

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PARD6B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE PARD6B (NP_067384). Peptide sequence SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PARD6B Antibody - BSA Free

Western Blot: PARD6B Antibody [NBP3-10560]

Western Blot: PARD6B Antibody [NBP3-10560]

Western Blot: PARD6B Antibody [NBP3-10560] - Western blot analysis of PARD6B in Human liver. Antibody dilution at 1 ug/mL

Applications for PARD6B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PARD6B

The PARD6B gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain, an OPR domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cytoplasmic protein is involved in asymmetrical cell division and cell pol

Alternate Names

par-6 (partitioning defective 6, C.elegans) homolog beta, PAR-6 beta, par-6 partitioning defective 6 homolog beta (C. elegans), PAR6B, PAR-6B, partitioning defective 6 homolog beta

Gene Symbol

PARD6B

Additional PARD6B Products

Product Documents for PARD6B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PARD6B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PARD6B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PARD6B Antibody - BSA Free and earn rewards!

Have you used PARD6B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies