PBXIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25042

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PBXIP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein PBXIP1 using the following amino acid sequence: PGVSANASKAWHQKSHFQNSREWSGKEKWWDGQRDRKAEHWKHKKEESGRERKKNWGGQEDREPAGRWKEGRPRVEESGSKKE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PBXIP1 Antibody - BSA Free

PBXIP1 Antibody Western Blot: PBXIP1 Antibody [NBP3-25042]

Western Blot: PBXIP1 Antibody [NBP3-25042]

Analysis in human cell line RT-4 and human cell line U-251 MG.
PBXIP1 Antibody Immunocytochemistry/Immunofluorescence: PBXIP1 Antibody [NBP3-25042]

Immunocytochemistry/Immunofluorescence: PBXIP1 Antibody [NBP3-25042]

Staining of human cell line U2OS shows localization to nucleoplasm & cytosol.

Applications for PBXIP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml

Western Blot

0.04-0.4 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PBXIP1

Hematopoietic PBX-interacting protein (HPIP) was identified in a yeast two-hybrid screen for factors that interact with PBX1, a homeodomain protein that regulates gene transcription during development and differentiation. Recently, HPIP has been reported to interact with estrogen receptor alpha (ERalpha) and estrogen receptor beta (ERbeta) and modulate ER target gene expression. Alternate names for HPIP include pre-b-cell leukemia transcription factor-interacting protein 1, hematopoietic PBX-interacting protein, and PBKIP1.

Alternate Names

Hematopoietic PBX-interacting protein, HPIPpre-B-cell leukemia transcription factor interacting protein 1, pre-B-cell leukemia homeobox interacting protein 1, pre-B-cell leukemia transcription factor-interacting protein 1

Gene Symbol

PBXIP1

Additional PBXIP1 Products

Product Documents for PBXIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PBXIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PBXIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PBXIP1 Antibody - BSA Free and earn rewards!

Have you used PBXIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies