PER2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88036

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PER2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PER2. Peptide sequence: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PER2 Antibody - BSA Free

Western Blot: PER2 Antibody [NBP2-88036]

Western Blot: PER2 Antibody [NBP2-88036]

Western Blot: PER2 Antibody [NBP2-88036] - WB Suggested Anti-PER2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Human Placenta
Western Blot: PER2 Antibody [NBP2-88036]

Western Blot: PER2 Antibody [NBP2-88036]

Western Blot: PER2 Antibody [NBP2-88036] - Host: Rabbit. Target Name: PER2. Sample Tissue: Human THP-1 Whole Cell. Antibody Dilution: 2ug/ml
Western Blot: PER2 Antibody [NBP2-88036]

Western Blot: PER2 Antibody [NBP2-88036]

Western Blot: PER2 Antibody [NBP2-88036] - Host: Rabbit. Target Name: PER2. Sample Type: Human Hela. Antibody Dilution: 1.0ug/ml

Applications for PER2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PER2

PER2 is a member of the Period protein family and a mammalian homolog of the Drosphilia period gene. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Strong PER2 expression in the suprachiasmatic nuclei of the mamalian brain indicates that the PER gene functions in the circadian clock with PER2 being a component of the circadian oscillator. PER2 shares a 40% homology with PER1 including the protein dimerization PAS domain.

Alternate Names

Circadian clock protein PERIOD 2, FASPS, hPER2, KIAA0347period 2, period (Drosophila) homolog 2, period circadian protein 2, period circadian protein homolog 2, period homolog 2 (Drosophila)

Gene Symbol

PER2

Additional PER2 Products

Product Documents for PER2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PER2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PER2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PER2 Antibody - BSA Free and earn rewards!

Have you used PER2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies