PER3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10333

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PER3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PER3 (NP_058515). Peptide sequence GAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAAL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

132 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PER3 Antibody - BSA Free

Western Blot: PER3 Antibody [NBP3-10333]

Western Blot: PER3 Antibody [NBP3-10333]

Western Blot: PER3 Antibody [NBP3-10333] - Western blot analysis using NBP3-10333 on Human Jurkat as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for PER3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PER3

PER3 is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. [provided by RefSeq]

Alternate Names

Cell growth-inhibiting gene 13 protein, Circadian clock protein PERIOD 3, GIG13, growth-inhibiting protein 13, hPER3, period (Drosophila) homolog 3, period 3, period circadian protein 3, period circadian protein homolog 3, period homolog 3 (Drosophila)

Gene Symbol

PER3

Additional PER3 Products

Product Documents for PER3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PER3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PER3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PER3 Antibody - BSA Free and earn rewards!

Have you used PER3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies