PFDN4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88039

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of PFDN4. Peptide sequence: ATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLED The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PFDN4 Antibody - BSA Free

Western Blot: PFDN4 Antibody [NBP2-88039]

Western Blot: PFDN4 Antibody [NBP2-88039]

Western Blot: PFDN4 Antibody [NBP2-88039] - WB Suggested Anti-PFDN4 Antibody. Titration: 1.0 ug/ml. Positive Control: MDA-MB-435S Whole CellPFDN4 is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells

Applications for PFDN4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PFDN4

PFDN4, also known as Prefoldin subunit 4, is a 134 amino acid protein that is 15 kDa, binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it, promotes folding in an environment in which there are many competing pathways for nonnative proteins, and is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. Current research is being performed on this protein involvement in b-cell non-hodgkin lymphoma, non-hodgkin lymphoma, hodgkin's lymphoma, hereditary angioedema, myocardial infarction, sinusitis, gastric cancer, colorectal cancer, breast cancer, cerebritis, cholesterol, and malaria. The PFDN4 has also been shown to have interactions with MAP3K3, ACTB, PRPF4, TUBA3E, PFDN2, and plus 80 other proteins in chaperonin-mediated protein folding, prefoldin mediated transfer of substrate to CCT/TriC, cooperation of Prefoldin and TriC/CCT in actin and tubulin folding, metabolism of proteins, and protein folding pathways.

Alternate Names

C-1, PFD4C1prefoldin 4, prefoldin subunit 4, Protein C-1

Gene Symbol

PFDN4

Additional PFDN4 Products

Product Documents for PFDN4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PFDN4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PFDN4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PFDN4 Antibody - BSA Free and earn rewards!

Have you used PFDN4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...