PFDN4 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-88526PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all PFDN4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PFDN4.

Source: E. coli

Amino Acid Sequence: DVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88526.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-88526PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PFDN4

PFDN4, also known as Prefoldin subunit 4, is a 134 amino acid protein that is 15 kDa, binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it, promotes folding in an environment in which there are many competing pathways for nonnative proteins, and is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. Current research is being performed on this protein involvement in b-cell non-hodgkin lymphoma, non-hodgkin lymphoma, hodgkin's lymphoma, hereditary angioedema, myocardial infarction, sinusitis, gastric cancer, colorectal cancer, breast cancer, cerebritis, cholesterol, and malaria. The PFDN4 has also been shown to have interactions with MAP3K3, ACTB, PRPF4, TUBA3E, PFDN2, and plus 80 other proteins in chaperonin-mediated protein folding, prefoldin mediated transfer of substrate to CCT/TriC, cooperation of Prefoldin and TriC/CCT in actin and tubulin folding, metabolism of proteins, and protein folding pathways.

Alternate Names

C-1, PFD4C1prefoldin 4, prefoldin subunit 4, Protein C-1

Gene Symbol

PFDN4

Additional PFDN4 Products

Product Documents for PFDN4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PFDN4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for PFDN4 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review PFDN4 Recombinant Protein Antigen and earn rewards!

Have you used PFDN4 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes