PHF5A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83391

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PHF5A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PHF5A. Peptide sequence: ICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PHF5A Antibody - BSA Free

Western Blot: PHF5A Antibody [NBP2-83391]

Western Blot: PHF5A Antibody [NBP2-83391]

Western Blot: PHF5A Antibody [NBP2-83391] - WB Suggested Anti-PHF5A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: OVCAR-3 cell lysate

Applications for PHF5A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PHF5A

PHF5A encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes. [provided by RefSeq]

Alternate Names

bK223H9.2, INI, MGC1346, PHD finger protein 5A, PHD finger-like domain protein 5A, PHD finger-like domain-containing protein 5A, PHD-finger 5a, Rds3, SAP14b, SF3b14bSplicing factor 3B-associated 14 kDa protein, splicing factor 3B associated 14 kDa protein

Gene Symbol

PHF5A

Additional PHF5A Products

Product Documents for PHF5A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PHF5A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PHF5A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PHF5A Antibody - BSA Free and earn rewards!

Have you used PHF5A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies