Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52964

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Phosphoribosyl Pyrophosphate Amidotransferase Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PPAT(phosphoribosyl pyrophosphate amidotransferase) The peptide sequence was selected from the N terminal of PPAT. Peptide sequence VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964]

Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964]

Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - 1. Human Skin Fibroblasts (100ug) 2. HepG2 cells (20 ug) 3. HEK273 cells (20 ug) 4. HeLa skin cells(20 ug) 5. Hamster CHO K1 cells (20 ug) Primary Dilution: 1 : 5000 Secondary Antibody: Clean-Blot IP detection Reagent and Kit Secondary Dilution: 1 : 2000.
Immunohistochemistry-Paraffin: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964]

Immunohistochemistry-Paraffin: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964]

Immunohistochemistry-Paraffin: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964]

Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964]

Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - HepG2 Cell Lysate, concentration 0.25ug/ml.

Applications for Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Phosphoribosyl Pyrophosphate Amidotransferase

PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. This gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Alternate Names

ATASE, EC 2.4.2.14, glutamine phosphoribosylpyrophosphatate amidotransferase, Glutamine phosphoribosylpyrophosphate amidotransferase, glutamine PRPP amidotransferase, GPATamidophosphoribosyltransferase, phosphoribosyl pyrophosphate amidotransferase, PRAT

Gene Symbol

PPAT

UniProt

Q06203 (Human)

Additional Phosphoribosyl Pyrophosphate Amidotransferase Products

Product Documents for Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free and earn rewards!

Have you used Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies