PIB5PA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82309

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PIB5PA. Peptide sequence: SSRERRGASRSPSPQSRRLSRVAPDRSSNGSSRGSSEEGPSGLPGPWAFP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

110 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PIB5PA Antibody - BSA Free

Western Blot: PIB5PA Antibody [NBP2-82309]

Western Blot: PIB5PA Antibody [NBP2-82309]

Western Blot: PIB5PA Antibody [NBP2-82309] - Host: Rabbit. Target Name: PI5PA. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for PIB5PA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIB5PA

PIB5PA, also referred to as Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A, has a long isoform that is 1,006 amino acids in length and 107 kDa, and two shorter isoforms that are 639 and 638 amino acids long. It is known that PIB5PA converts phosphatidylinositol 4,5-bisphosphate to phosphatidylinositol 4-phosphate, and it is thought that PIB5PA may mediate the function of plasma membrane proteins. Research is currently being conducted on PIB5PA in relation to several diseases and disorders including breast cancer, Guillain-Barre syndrome, developmental disorders and Autoimmune Lymphoproliferative Syndrome. PIB5PA has also been shown to have interactions with INPP1, PTEN, ITPK1, INPP4A and ITPKA in pathways such as lipid metabolism and lipoprotein metabolism.

Alternate Names

A, inositol polyphosphate 5-phosphatase J, inositol polyphosphate-5-phosphatase J, phosphatidylinositol 4,5-bisphosphate 5-phosphatase A, PIPP

Gene Symbol

INPP5J

Additional PIB5PA Products

Product Documents for PIB5PA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PIB5PA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIB5PA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIB5PA Antibody - BSA Free and earn rewards!

Have you used PIB5PA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...