PIGA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87967

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PIGA. Peptide sequence: NHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PIGA Antibody - BSA Free

Western Blot: PIGA Antibody [NBP2-87967]

Western Blot: PIGA Antibody [NBP2-87967]

Western Blot: PIGA Antibody [NBP2-87967] - WB Suggested Anti-PIGA Antibody Titration: 0.2-1 ug/ml. Positive Control: OVCAR-3 cell lysate

Applications for PIGA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PIGA

PIGA, also known as Phosphatidylinositol N-acetylglucosaminyltransferase subunit A, has three isoforms that are produced by alternative splicing. Isoform 1, the canonical sequence, is 484 amino acids long and 54 kDa. Isoform 2 and 3 are both shorter isoforms, at 315 and 250 amino acids, respectively. PIGA is a critical player in the synthesis of N-acetylglucosaminyl-phosphatidylinositol, which is the first intermediate in the biosynthesis of GPI anchors. Current research on PIGA is being conducted in relation to several diseases and disorders including Paroxysmal nocturnal hemoglobinuria, which may be caused by mutations in the PIGA gene. Other diseases and disorders related to PIGA include multiple congenital anomalies-hypotonia-seizures syndrome type 2, anemia, Burkitt's lymphoma, hepatic vein thrombosis and Myelodysplastic syndrome. PIGA has been shown to have interactions with DPM2, PIGQ, PIGH, PYURF and PIGP in pathways such as GPI anchor biosynthesis and metabolic pathways.

Alternate Names

class A GlcNAc-inositol phospholipid assembly protein, EC 2.4.1.198, GlcNAc-PI synthesis protein, GPI anchor biosynthesis, GPI3, phosphatidylinositol glycan anchor biosynthesis, class A, phosphatidylinositol glycan, class A (paroxysmal nocturnal hemoglobinuria), phosphatidylinositol N-acetylglucosaminyltransferase subunit A, Phosphatidylinositol-glycan biosynthesis class A protein, phosphatidylinositol-glycan biosynthesis, class A protein, PIG-A

Gene Symbol

PIGA

Additional PIGA Products

Product Documents for PIGA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PIGA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PIGA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PIGA Antibody - BSA Free and earn rewards!

Have you used PIGA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...