PKDREJ Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83398

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PKDREJ Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PKDREJ. Peptide sequence: GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PKDREJ Antibody - BSA Free

Western Blot: PKDREJ Antibody [NBP2-83398]

Western Blot: PKDREJ Antibody [NBP2-83398]

Western Blot: PKDREJ Antibody [NBP2-83398] - WB Suggested Anti-PKDREJ Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: HepG2 cell lysate

Applications for PKDREJ Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PKDREJ

PKDREJ encodes a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction. Alternative splice variants have been described but their biological natures have not been determined.; FUNCTION: May have a central role in fertilization. May generate a Ca(2+) transporting channel directly involved in initiating the acrosome reaction of the sperm. SUBUNIT: May form homomultimers or heteromultimers in combination with an as yet unidentified subunits. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein.; TISSUE SPECIFICITY: Exclusively expressed in testis.

Alternate Names

PKD and REJ homolog, polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg jelly homolog, sea urchin)

Gene Symbol

PKDREJ

Additional PKDREJ Products

Product Documents for PKDREJ Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PKDREJ Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PKDREJ Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PKDREJ Antibody - BSA Free and earn rewards!

Have you used PKDREJ Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies