POU6F2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82314

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POU6F2. Peptide sequence: AATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for POU6F2 Antibody - BSA Free

Western Blot: POU6F2 Antibody [NBP2-82314]

Western Blot: POU6F2 Antibody [NBP2-82314]

Western Blot: POU6F2 Antibody [NBP2-82314] - WB Suggested Anti-POU6F2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate

Applications for POU6F2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POU6F2

POU6F2, also known as POU domain, class 6, transcription factor 2, is a transcription factor that belongs to the POU protein family. POU6F2 may be implicated in the differentiation of ganglion cells and amacrine cells. Current research on POU6F2 is being performed in relation to several diseases and disorders including Wilms' tumor, retinitis, twinning and neuronitis. Plexin C1 has also been shown to have interactions with SEMA7A in the axon guidance pathway. POU6F2 has also been shown to interact with POU6F1.

Alternate Names

POU class 6 homeobox 2, Retina-derived POU domain factor 1, retina-derived POU-domain factor-1, RPF1, RPF-1, RPF-1class 6, transcription factor 2, Wilms tumor suppressor locus, WT5, WTSL

Gene Symbol

POU6F2

Additional POU6F2 Products

Product Documents for POU6F2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POU6F2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POU6F2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POU6F2 Antibody - BSA Free and earn rewards!

Have you used POU6F2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...